Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10P1 Rabbit Polyclonal Antibody (HRP)

OR10P1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR12-7, OST701, OR10P1P, OR10P2P, OR10P3P

UniProt

Q8NGE3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10P1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_996782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor) (Not for Export EU)
A4152-30C 100 µL

Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor) (Not for Export EU)

Sign In for Pricing
View Details
PerCP-Cy5.5 human CD5 Antibody
orb3065834-01 25 Tests

PerCP-Cy5.5 human CD5 Antibody

Sign In for Pricing
View Details
PerCP-Cy5.5 human CD5 Antibody
orb3065834-02 100 Tests

PerCP-Cy5.5 human CD5 Antibody

Sign In for Pricing
View Details
OTC Peptide
MBS3230989-01 0.1 mg

OTC Peptide

Sign In for Pricing
View Details
OTC Peptide
MBS3230989-02 5x 0.1 mg

OTC Peptide

Sign In for Pricing
View Details
ITGBL1 (Integrin beta-like Protein 1, Osteoblast-specific Cysteine-rich Protein, Ten Integrin EGF-like Repeat Domain-containing Protein, OSCP, TIED) (MaxLight 490)
138058-ML490 100 µL

ITGBL1 (Integrin beta-like Protein 1, Osteoblast-specific Cysteine-rich Protein, Ten Integrin EGF-like Repeat Domain-containing Protein, OSCP, TIED) (MaxLight 490)

Sign In for Pricing
View Details