Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51A7 Rabbit Polyclonal Antibody (HRP)

OR51A7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-27

UniProt

Q8NH64

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51A7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IPFPFTLRRLKYCQKNLLSHSYCLHQDTMKLACSDNKTNVIYGFFIALCT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004749

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab27a Rabbit pAb, PE-Cy5 conjugated
orb2890680 100 µL

Rab27a Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
CTRL, ID (CTRL, CTRL1, Chymotrypsin-like protease CTRL-1) (MaxLight 650)
MBS6289888-01 0.1 mL

CTRL, ID (CTRL, CTRL1, Chymotrypsin-like protease CTRL-1) (MaxLight 650)

Sign In for Pricing
View Details
CTRL, ID (CTRL, CTRL1, Chymotrypsin-like protease CTRL-1) (MaxLight 650)
MBS6289888-02 5x 0.1 mL

CTRL, ID (CTRL, CTRL1, Chymotrypsin-like protease CTRL-1) (MaxLight 650)

Sign In for Pricing
View Details
TAT, ID (TAT, Tyrosine aminotransferase, L-tyrosine:2-oxoglutarate aminotransferase) (MaxLight 405)
MBS6353759-01 0.1 mL

TAT, ID (TAT, Tyrosine aminotransferase, L-tyrosine:2-oxoglutarate aminotransferase) (MaxLight 405)

Sign In for Pricing
View Details
TAT, ID (TAT, Tyrosine aminotransferase, L-tyrosine:2-oxoglutarate aminotransferase) (MaxLight 405)
MBS6353759-02 5x 0.1 mL

TAT, ID (TAT, Tyrosine aminotransferase, L-tyrosine:2-oxoglutarate aminotransferase) (MaxLight 405)

Sign In for Pricing
View Details
Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla) (BSA & Azide Free) (HRP)
MBS6266647-01 0.1 mL

Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla) (BSA & Azide Free) (HRP)

Sign In for Pricing
View Details