Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51M1 Rabbit Polyclonal Antibody (HRP)

OR51M1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-40, HOR5'Beta7

UniProt

B2RNI9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51M1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LYGLMVVVFTVMLDLVLIALSYGLILHTVAGLASQEEQRRAFQTCTAHRC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001004756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M/M069/NT-PE-DIA315/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)
321112 1 Pack (1 Panel (s) x 1 Pack)

M/M069/NT-PE-DIA315/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Zfp229 (NM_001164676) Mouse Tagged ORF Clone
MG212891 10 µg

Zfp229 (NM_001164676) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DNA-directed RNA polymerase I, II and III subunit RPABC5 (POLR2L) Bovine ELISA Kit
C9679 96 Tests

DNA-directed RNA polymerase I, II and III subunit RPABC5 (POLR2L) Bovine ELISA Kit

Sign In for Pricing
View Details
PE-Cy5 Anti-Mouse CD335/NKp46 Antibody (29A1.4)
PC5-30114U-01 25 µg

PE-Cy5 Anti-Mouse CD335/NKp46 Antibody (29A1.4)

Sign In for Pricing
View Details
PE-Cy5 Anti-Mouse CD335/NKp46 Antibody (29A1.4)
PC5-30114U-02 100 µg

PE-Cy5 Anti-Mouse CD335/NKp46 Antibody (29A1.4)

Sign In for Pricing
View Details
CALHM1 Polyclonal Antibody
RD84760A-01 60μL

CALHM1 Polyclonal Antibody

Sign In for Pricing
View Details