Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51M1 Rabbit Polyclonal Antibody (HRP)

OR51M1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-40, HOR5'Beta7

UniProt

B2RNI9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51M1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LYGLMVVVFTVMLDLVLIALSYGLILHTVAGLASQEEQRRAFQTCTAHRC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001004756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uprt sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3214807 1.0 µg DNA

Uprt sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Clostridium Difficile hisA Protein (aa 1-240)
VAng-Lsx9189-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Difficile hisA Protein (aa 1-240)

Sign In for Pricing
View Details
CDK1 pTyr15 Rabbit Polyclonal Antibody
AP20928PU-N 100 µg

CDK1 pTyr15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Hoxc8 Pre-designed siRNA Set B
SI106321B 1 Each

Mouse Hoxc8 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Buxbodine B
379737 5 mg

Buxbodine B

Sign In for Pricing
View Details
LIPT2 (NM_001144869) Human Untagged Clone
SC325636 10 µg

LIPT2 (NM_001144869) Human Untagged Clone

Sign In for Pricing
View Details