Animal-Free CXCL13, Pig (His)
The CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. Animal-Free CXCL13 Protein, Pig (His) is the recombinant pig-derived animal-FreeCXCL13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free CXCL13 Protein, Pig (His), Pig, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-cxcl13-protein-pig-his.html
Smiles
VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA
Molecular Formula
100524265 (Gene_ID) A0A4X1SVT8 (V24-A111) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog