Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52E6 Rabbit Polyclonal Antibody (HRP)

OR52E6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-58

UniProt

Q96RD3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52E6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FFSFFTHCFGHDIPQYIHIFLANLYVVVPPTLNPVIYGVRTKHIRETVLR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Coagulation Factor XIII A1 Polypeptide ELISA Kit
MBS727678-01 48 Well

Rabbit Coagulation Factor XIII A1 Polypeptide ELISA Kit

Sign In for Pricing
View Details
Rabbit Coagulation Factor XIII A1 Polypeptide ELISA Kit
MBS727678-02 96 Well

Rabbit Coagulation Factor XIII A1 Polypeptide ELISA Kit

Sign In for Pricing
View Details
Rabbit Coagulation Factor XIII A1 Polypeptide ELISA Kit
MBS727678-03 5x 96 Well

Rabbit Coagulation Factor XIII A1 Polypeptide ELISA Kit

Sign In for Pricing
View Details
Rabbit Coagulation Factor XIII A1 Polypeptide ELISA Kit
MBS727678-04 10x 96 Well

Rabbit Coagulation Factor XIII A1 Polypeptide ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Feline Foamy Virus (FFV) Pro-Pol Polyprotein Polyclonal Antibody
VD11Y616 1 Each

Rabbit Anti-Feline Foamy Virus (FFV) Pro-Pol Polyprotein Polyclonal Antibody

Sign In for Pricing
View Details
3-Amino-4-nitro-N, N-dimethylaniline
OR13066 1 Each

3-Amino-4-nitro-N, N-dimethylaniline

Sign In for Pricing
View Details