Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52N5 Rabbit Polyclonal Antibody (HRP)

OR52N5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-62, OR52N5Q

UniProt

Q8NH56

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52N5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GHTIPPSLHIIVANLYLLLPPTLNPIVYGVKTKQIRKSVIKFFQGDKGAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001922

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il9 (NM_008373) Mouse Tagged ORF Clone
MR227007 10 µg

Il9 (NM_008373) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tumor Protein P53 Phospho-Ser392 (TP53 pS392) Antibody
abx125457-01 50 µL

Tumor Protein P53 Phospho-Ser392 (TP53 pS392) Antibody

Sign In for Pricing
View Details
Tumor Protein P53 Phospho-Ser392 (TP53 pS392) Antibody
abx125457-02 100 µL

Tumor Protein P53 Phospho-Ser392 (TP53 pS392) Antibody

Sign In for Pricing
View Details
Tumor Protein P53 Phospho-Ser392 (TP53 pS392) Antibody
abx125457-03 200 µL

Tumor Protein P53 Phospho-Ser392 (TP53 pS392) Antibody

Sign In for Pricing
View Details
ZNF443, NT (ZNF443, Zinc finger protein 443, Krueppel-type zinc finger protein ZK1) (MaxLight 750)
MBS6366655-01 0.1 mL

ZNF443, NT (ZNF443, Zinc finger protein 443, Krueppel-type zinc finger protein ZK1) (MaxLight 750)

Sign In for Pricing
View Details
ZNF443, NT (ZNF443, Zinc finger protein 443, Krueppel-type zinc finger protein ZK1) (MaxLight 750)
MBS6366655-02 5x 0.1 mL

ZNF443, NT (ZNF443, Zinc finger protein 443, Krueppel-type zinc finger protein ZK1) (MaxLight 750)

Sign In for Pricing
View Details