Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52W1 Rabbit Polyclonal Antibody (Biotin)

OR52W1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR11-71, OR52W1P

UniProt

Q6IF63

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52W1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005178

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccl11 (NM_019205) Rat Untagged Clone
RN204883 10 µg

Ccl11 (NM_019205) Rat Untagged Clone

Sign In for Pricing
View Details
ITGA1 (Integrin alpha-1, Integrin, alpha 1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (FITC)
MBS6147821-01 0.1 mL

ITGA1 (Integrin alpha-1, Integrin, alpha 1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (FITC)

Sign In for Pricing
View Details
ITGA1 (Integrin alpha-1, Integrin, alpha 1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (FITC)
MBS6147821-02 5x 0.1 mL

ITGA1 (Integrin alpha-1, Integrin, alpha 1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (FITC)

Sign In for Pricing
View Details
Zfp639 (NM_144519) Mouse Tagged Lenti ORF Clone
MR207772L3 10 µg

Zfp639 (NM_144519) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CYP2W1 Human shRNA Plasmid Kit (Locus ID 54905)
TR305126 1 Kit

CYP2W1 Human shRNA Plasmid Kit (Locus ID 54905)

Sign In for Pricing
View Details
Gimeracil Impurity 18
RM-G131818-01 10 mg

Gimeracil Impurity 18

Sign In for Pricing
View Details