Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52W1 Rabbit Polyclonal Antibody (FITC)

OR52W1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR11-71, OR52W1P

UniProt

Q6IF63

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52W1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005178

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A Sulfonyl Chloride
HA4004500431.25G 25 g

Polystyrene A Sulfonyl Chloride

Sign In for Pricing
View Details
Porcine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit
RD-TNFa-p-01 96 Tests

Porcine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

Sign In for Pricing
View Details
Porcine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit
RD-TNFa-p-02 48 Tests

Porcine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

Sign In for Pricing
View Details
ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF647 conjugate, 0.1mg/mL
BNC473111-500 1x 500 µL

ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRRX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H3]
TA803165AM 100 µL

PRRX1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H3]

Sign In for Pricing
View Details
Alpk3 Mouse Gene Knockout Kit (CRISPR)
KN501166 1 Kit

Alpk3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details