Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR56A3 Rabbit Polyclonal Antibody (Biotin)

OR56A3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR56A6, OR56A2P, OR56A3P

UniProt

Q8NH54

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR56A3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RAVLRLKAEGAVAKALSTCGSHFMLILFFSTILLVFVLTHVAKKKVSPDV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001003443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BRD2 sgRNA gene knockout kit - Lentiviral human BRD2 sgRNA gene knockout kit (25)
GTR15377565 1 Vial

Lentiviral human BRD2 sgRNA gene knockout kit - Lentiviral human BRD2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 Na(+)-translocating NADH-quinone reductase subunit E
MBS7023563-01 0.02 mg

Recombinant Actinobacillus pleuropneumoniae serotype 3 Na(+)-translocating NADH-quinone reductase subunit E

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 Na(+)-translocating NADH-quinone reductase subunit E
MBS7023563-02 0.1 mg

Recombinant Actinobacillus pleuropneumoniae serotype 3 Na(+)-translocating NADH-quinone reductase subunit E

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 Na(+)-translocating NADH-quinone reductase subunit E
MBS7023563-03 5x 0.1 mg

Recombinant Actinobacillus pleuropneumoniae serotype 3 Na(+)-translocating NADH-quinone reductase subunit E

Sign In for Pricing
View Details
Mouse Toll-like receptor 8 (TLR8) ELISA Kit
orb1656981-01 48 Tests

Mouse Toll-like receptor 8 (TLR8) ELISA Kit

Sign In for Pricing
View Details
Mouse Toll-like receptor 8 (TLR8) ELISA Kit
orb1656981-02 96 Tests

Mouse Toll-like receptor 8 (TLR8) ELISA Kit

Sign In for Pricing
View Details