Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR56B1 Rabbit Polyclonal Antibody (HRP)

OR56B1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-65, OR56B1P

UniProt

Q8NGI3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human OR56B1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILKATLFMVLRNGLFVTPVPVLAAQRDYCSKNEIEHCLCSNLGVTSLACD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G protein alpha 12 (GNA12) Rabbit Polyclonal Antibody
AP14960PU-N 400 µL

G protein alpha 12 (GNA12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD5 (C5/473 + CD5/54/F6), CF405S conjugate, 0.1mg/mL
BNC040748-500 1x 500 µL

CD5 (C5/473 + CD5/54/F6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LAF4 (AFF3) (NM_002285) Human Over-expression Lysate
LC419437 20 µg

LAF4 (AFF3) (NM_002285) Human Over-expression Lysate

Sign In for Pricing
View Details
RBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E1]
TA502835AM 100 µL

RBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E1]

Sign In for Pricing
View Details
Human sVCAM-1/CD106 (Soluble Vascular Cell Adhesion Molecule 1) ELISA Kit
E-EL-H2166-01 24 Tests

Human sVCAM-1/CD106 (Soluble Vascular Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human sVCAM-1/CD106 (Soluble Vascular Cell Adhesion Molecule 1) ELISA Kit
E-EL-H2166-02 48 Tests

Human sVCAM-1/CD106 (Soluble Vascular Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details