Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOGL Rabbit Polyclonal Antibody (FITC)

OTOGL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C12orf64

UniProt

Q3ZCN5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human OTOGL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IQYLCEKDDVCVFQEVSVLNPGQSMIKYLEEDFCYAIECLEEKDNHTGFH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Rat A disintegrin and metalloproteinase with thrombospondin motifs 7 (ADAMTS7)
KTE100334-01 48 Tests

ELISA kit for Rat A disintegrin and metalloproteinase with thrombospondin motifs 7 (ADAMTS7)

Sign In for Pricing
View Details
ELISA kit for Rat A disintegrin and metalloproteinase with thrombospondin motifs 7 (ADAMTS7)
KTE100334-02 96 Tests

ELISA kit for Rat A disintegrin and metalloproteinase with thrombospondin motifs 7 (ADAMTS7)

Sign In for Pricing
View Details
ELISA kit for Rat A disintegrin and metalloproteinase with thrombospondin motifs 7 (ADAMTS7)
KTE100334-03 5x 96 Well

ELISA kit for Rat A disintegrin and metalloproteinase with thrombospondin motifs 7 (ADAMTS7)

Sign In for Pricing
View Details
ABCB11 Rabbit Polyclonal Antibody (APC)
orb2621787 100 µg

ABCB11 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
SARS-CoV-2 Spike-RBD Protein (V483A) Mutant MN908947) COVID-19 Recombinant Protein
E45O49290M2 50 µg

SARS-CoV-2 Spike-RBD Protein (V483A) Mutant MN908947) COVID-19 Recombinant Protein

Sign In for Pricing
View Details
Human LINGO4 Pre-designed siRNA Set A
SI008744A 1 Each

Human LINGO4 Pre-designed siRNA Set A

Sign In for Pricing
View Details