Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOGL Rabbit Polyclonal Antibody (FITC)

OTOGL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C12orf64

UniProt

Q3ZCN5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human OTOGL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IQYLCEKDDVCVFQEVSVLNPGQSMIKYLEEDFCYAIECLEEKDNHTGFH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPCAM Recombinant Protein (Human)
OPCA04220-20UG 20 µg

EPCAM Recombinant Protein (Human)

Sign In for Pricing
View Details
DIO1, NT (Type I Iodothyronine Deiodinase, Type-I 5'-deiodinase, Type 1 DI, DIOI, 5DI, TXDI1, ITDI1) (MaxLight 750)
MBS6471941-01 0.1 mL

DIO1, NT (Type I Iodothyronine Deiodinase, Type-I 5'-deiodinase, Type 1 DI, DIOI, 5DI, TXDI1, ITDI1) (MaxLight 750)

Sign In for Pricing
View Details
DIO1, NT (Type I Iodothyronine Deiodinase, Type-I 5'-deiodinase, Type 1 DI, DIOI, 5DI, TXDI1, ITDI1) (MaxLight 750)
MBS6471941-02 5x 0.1 mL

DIO1, NT (Type I Iodothyronine Deiodinase, Type-I 5'-deiodinase, Type 1 DI, DIOI, 5DI, TXDI1, ITDI1) (MaxLight 750)

Sign In for Pricing
View Details
Human Protein Arginine Methyltransferase 1 (PRMT1) ELISA Kit
orb779448-01 48 Tests

Human Protein Arginine Methyltransferase 1 (PRMT1) ELISA Kit

Sign In for Pricing
View Details
Human Protein Arginine Methyltransferase 1 (PRMT1) ELISA Kit
orb779448-02 96 Tests

Human Protein Arginine Methyltransferase 1 (PRMT1) ELISA Kit

Sign In for Pricing
View Details
TRMT112 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
47866124 3x 1.0µg DNA

TRMT112 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details