Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OVCH2 Rabbit Polyclonal Antibody (FITC)

OVCH2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OVTN

UniProt

Q7RTZ1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human OVCH2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IQSLNYPENYSDKANCDWIFQASKHHLIKLSFQSLEIEESGDCTSDYVTV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACR1/NK1R Antibody
orb1533462 50 µg

TACR1/NK1R Antibody

Sign In for Pricing
View Details
Syncrip 3'UTR Luciferase Stable Cell Line
TU221461 1.0 mL

Syncrip 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GPI, CT (GPI, Glucose-6-phosphate isomerase, Autocrine motility factor, Neuroleukin, Phosphoglucose isomerase, Phosphohexose isomerase, Sperm antigen 36) (AP) discontinued
036202-AP 200 µL

GPI, CT (GPI, Glucose-6-phosphate isomerase, Autocrine motility factor, Neuroleukin, Phosphoglucose isomerase, Phosphohexose isomerase, Sperm antigen 36) (AP) discontinued

Sign In for Pricing
View Details
WDR42A (WD Repeat Domain 42A, DKFZp781G1096, FLJ35857, H326, MGC117276, MGC118891, MGC99640) (APC)
MBS6169567-01 0.1 mL

WDR42A (WD Repeat Domain 42A, DKFZp781G1096, FLJ35857, H326, MGC117276, MGC118891, MGC99640) (APC)

Sign In for Pricing
View Details
WDR42A (WD Repeat Domain 42A, DKFZp781G1096, FLJ35857, H326, MGC117276, MGC118891, MGC99640) (APC)
MBS6169567-02 5x 0.1 mL

WDR42A (WD Repeat Domain 42A, DKFZp781G1096, FLJ35857, H326, MGC117276, MGC118891, MGC99640) (APC)

Sign In for Pricing
View Details
Recombinant Human SULT4A1 Protein
MBS8249847-01 0.01 mg

Recombinant Human SULT4A1 Protein

Sign In for Pricing
View Details