Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OVCH2 Rabbit Polyclonal Antibody (HRP)

OVCH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OVTN

UniProt

Q7RTZ1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human OVCH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTVHSDVERKKEIARLCGYDVPTPVLSPSSIMLISFHSDENGTCRGFQAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ly-49F (m) -PR
sc-72051-PR 10 µM - 20 µL

Ly-49F (m) -PR

Sign In for Pricing
View Details
Nin Rat shRNA Lentiviral Particle (Locus ID 299117)
TL705311V 500 µL Each

Nin Rat shRNA Lentiviral Particle (Locus ID 299117)

Sign In for Pricing
View Details
Aste1 (NM_025651) Mouse Tagged ORF Clone Lentiviral Particle
MR216590L4V 200 µL

Aste1 (NM_025651) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Anti-Human TBP Polyclonal Antibody
PA84925HU-01 50 µg

Rabbit Anti-Human TBP Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human TBP Polyclonal Antibody
PA84925HU-02 100 µg

Rabbit Anti-Human TBP Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human TBP Polyclonal Antibody
PA84925HU-03 500 µg

Rabbit Anti-Human TBP Polyclonal Antibody

Sign In for Pricing
View Details