Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATB Rabbit Polyclonal Antibody (Biotin)

GATB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PET112, COXPD41, HSPC199, PET112L

UniProt

O75879

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PET112

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004555

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINH1, CT (Serpin H1, Collagen-binding Protein, Colligin, 47kD Heat Shock Protein, Rheumatoid Arthritis-related Antigen RA-A47, Arsenic-transactivated Protein 3, AsTP3, Cell Proliferation-inducing Gene 14 Protein, PIG14, SERPINH2, HSP47, CBP2, CBP1) (Azide free) (HRP) discontinued
S1000-78E-HRP 200 µL

SERPINH1, CT (Serpin H1, Collagen-binding Protein, Colligin, 47kD Heat Shock Protein, Rheumatoid Arthritis-related Antigen RA-A47, Arsenic-transactivated Protein 3, AsTP3, Cell Proliferation-inducing Gene 14 Protein, PIG14, SERPINH2, HSP47, CBP2, CBP1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Fmoc-NH-PEG2-NHS ester
HY-160072 1 Each

Fmoc-NH-PEG2-NHS ester

Sign In for Pricing
View Details
Rat Itga2 Pre-designed siRNA Set A
SI206903A 1 Each

Rat Itga2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-beta Catenin/CTNNB1 Antibody Picoband®, Cy3 Conjugate
PA1212-Cy3 100 µg/Vial

Anti-beta Catenin/CTNNB1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
RXRG (Retinoic Acid Receptor RXR-gamma, Nuclear Receptor Subfamily 2 Group B Member 3, Retinoid X Receptor gamma, NR2B3) (MaxLight 405) discontinued
132908-ML405 100 µL

RXRG (Retinoic Acid Receptor RXR-gamma, Nuclear Receptor Subfamily 2 Group B Member 3, Retinoid X Receptor gamma, NR2B3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rat Induced nitric oxide Synthase (INOS NOS2) ELISA Kit
YP-W34453-01 48 Tests

Rat Induced nitric oxide Synthase (INOS NOS2) ELISA Kit

Sign In for Pricing
View Details