Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCXD3 Rabbit Polyclonal Antibody (HRP)

PLCXD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q63HM9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLCXD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVELG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005473

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)
MBS2154132-01 0.01 mg

Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)
MBS2154132-02 0.05 mg

Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)
MBS2154132-03 0.1 mg

Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)
MBS2154132-04 0.2 mg

Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)
MBS2154132-05 0.5 mg

Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)
MBS2154132-06 1 mg

Recombinant Tankyrase 1 Binding Protein 1 (TNKS1BP1)

Sign In for Pricing
View Details