Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POTEB Rabbit Polyclonal Antibody (FITC)

POTEB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A26B1, POTE15, POTEB2, CT104.5, POTE-15

UniProt

Q6S5H4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human POTEB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGNGDDGLIPQRKSRKPENQQFPDTENEEYHSDEQNDTQKQLSEEQNTGI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_997238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fibronectin Leucine Rich Transmembrane Protein 2 ELISA Kit
MBS032576-01 48 Well

Mouse Fibronectin Leucine Rich Transmembrane Protein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibronectin Leucine Rich Transmembrane Protein 2 ELISA Kit
MBS032576-02 96 Well

Mouse Fibronectin Leucine Rich Transmembrane Protein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibronectin Leucine Rich Transmembrane Protein 2 ELISA Kit
MBS032576-03 5x 96 Well

Mouse Fibronectin Leucine Rich Transmembrane Protein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibronectin Leucine Rich Transmembrane Protein 2 ELISA Kit
MBS032576-04 10x 96 Well

Mouse Fibronectin Leucine Rich Transmembrane Protein 2 ELISA Kit

Sign In for Pricing
View Details
Vimentin Antibody
3634-100 100 µg

Vimentin Antibody

Sign In for Pricing
View Details
Lentiviral mouse Hus1 shRNA (UAS) - Lentiviral mouse Hus1 shRNA (UAS) (100)
GTR15287982 1 Vial

Lentiviral mouse Hus1 shRNA (UAS) - Lentiviral mouse Hus1 shRNA (UAS) (100)

Sign In for Pricing
View Details