Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRRT4 Rabbit Polyclonal Antibody (FITC)

PRRT4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRRT4

UniProt

C9JH25

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRRT4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTEWGSTEGGSKPRASSLLPESTSRRSGPSDGPTAPYQPRRSTVTWDTAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005250401

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E4F1 (Transcription Factor E4F1, E4F Transcription Factor 1, Putative E3 Ubiquitin-protein Ligase E4F1, Transcription Factor E4F, p120E4F, p50E4F, E4F, MGC99614) (MaxLight 750) discontinued
126125-ML750 100 µL

E4F1 (Transcription Factor E4F1, E4F Transcription Factor 1, Putative E3 Ubiquitin-protein Ligase E4F1, Transcription Factor E4F, p120E4F, p50E4F, E4F, MGC99614) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)
MBS2166351-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)
MBS2166351-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)
MBS2166351-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)
MBS2166351-04 1 mL

Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)
MBS2166351-05 5 mL

Cy3-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)

Sign In for Pricing
View Details