Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTAR1 Rabbit Polyclonal Antibody (HRP)

PTAR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7Z6K3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTAR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LISQTVIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRINLPHLLEEEV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001093136

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ovine Insulin Like Growth Factor 2 (IGF2) ELISA Kit-Sandwich
EK8F136-01 48 Test

Ovine Insulin Like Growth Factor 2 (IGF2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Ovine Insulin Like Growth Factor 2 (IGF2) ELISA Kit-Sandwich
EK8F136-02 96 Tests

Ovine Insulin Like Growth Factor 2 (IGF2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Lman2 Antibody - N-terminal region : Biotin (ARP62101_P050-Biotin)
ARP62101_P050-Biotin 100 µL

Lman2 Antibody - N-terminal region : Biotin (ARP62101_P050-Biotin)

Sign In for Pricing
View Details
Anti-Mouse CD11a Monoclonal Antibody (PE/Cy5 Conjugated)
MBS2556848-01 50 Tests

Anti-Mouse CD11a Monoclonal Antibody (PE/Cy5 Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD11a Monoclonal Antibody (PE/Cy5 Conjugated)
MBS2556848-02 100 Tests

Anti-Mouse CD11a Monoclonal Antibody (PE/Cy5 Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD11a Monoclonal Antibody (PE/Cy5 Conjugated)
MBS2556848-03 2x 100 Tests

Anti-Mouse CD11a Monoclonal Antibody (PE/Cy5 Conjugated)

Sign In for Pricing
View Details