Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN20 Rabbit Polyclonal Antibody (HRP)

PTPN20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT126, PTPN20A, PTPN20B, bA42B19.1, bA142I17.1

UniProt

Q4JDL3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PTPN20B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluo -2 AM - Green fluorescent calcium indicator
1021B 1 mg

Fluo -2 AM - Green fluorescent calcium indicator

Sign In for Pricing
View Details
H3.3A (H3F3A) Rabbit Polyclonal Antibody
AP06614PU-N 100 µg

H3.3A (H3F3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562985 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
VPS41 (NM_080631) Human Over-expression Lysate
LY403311 100 µg

VPS41 (NM_080631) Human Over-expression Lysate

Sign In for Pricing
View Details
PD L1 (CD274) Mouse Monoclonal Antibody [Clone ID: J110]
AM26478FC-N 50 µg

PD L1 (CD274) Mouse Monoclonal Antibody [Clone ID: J110]

Sign In for Pricing
View Details
TMBIM1 Human Gene Knockout Kit (CRISPR)
KN402350 1 Kit

TMBIM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details