Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PUS7L Rabbit Polyclonal Antibody (FITC)

PUS7L Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H0K6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PUS7L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_112582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COG4 siRNA (Human)
CRH8534-01 15 nmol

COG4 siRNA (Human)

Sign In for Pricing
View Details
COG4 siRNA (Human)
CRH8534-02 30 nmol

COG4 siRNA (Human)

Sign In for Pricing
View Details
KCMF1, CT (KCMF1, FIGC, ZZZ1, E3 ubiquitin-protein ligase KCMF1, FGF-induced in gastric cancer, Potassium channel modulatory factor, ZZ-type zinc finger-containing protein 1) (AP)
MBS6312192-01 0.2 mL

KCMF1, CT (KCMF1, FIGC, ZZZ1, E3 ubiquitin-protein ligase KCMF1, FGF-induced in gastric cancer, Potassium channel modulatory factor, ZZ-type zinc finger-containing protein 1) (AP)

Sign In for Pricing
View Details
KCMF1, CT (KCMF1, FIGC, ZZZ1, E3 ubiquitin-protein ligase KCMF1, FGF-induced in gastric cancer, Potassium channel modulatory factor, ZZ-type zinc finger-containing protein 1) (AP)
MBS6312192-02 5x 0.2 mL

KCMF1, CT (KCMF1, FIGC, ZZZ1, E3 ubiquitin-protein ligase KCMF1, FGF-induced in gastric cancer, Potassium channel modulatory factor, ZZ-type zinc finger-containing protein 1) (AP)

Sign In for Pricing
View Details
Mouse Ankrd39 Pre-designed siRNA Set A
SI100664A 1 Each

Mouse Ankrd39 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-DCC Antibody
CPA3198-01 30 µL

Anti-DCC Antibody

Sign In for Pricing
View Details