Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYROXD1 Rabbit Polyclonal Antibody (FITC)

PYROXD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MFM8

UniProt

B3KWN8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PYROXD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGNPYVLGIR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_079130.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit
MBS2089577-01 24 Strip Well

Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit
MBS2089577-02 48 Strip Well

Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit
MBS2089577-03 96 Strip Well

Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit
MBS2089577-04 5x 96 Strip Well

Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit
MBS2089577-05 10x 96 Strip Well

Mouse Interleukin 17C (IL17C) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Guinea Pig IgG H&L Secondary Antibody-Gold
TMAB-02040G-01 500 μL

Rabbit Anti-Guinea Pig IgG H&L Secondary Antibody-Gold

Sign In for Pricing
View Details