Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH6A Rabbit Polyclonal Antibody (Biotin)

RSPH6A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RSP4, RSP6, RSHL1, RSPH4B

UniProt

Q9H0K4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RSPH6A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_110412

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNKSR3 (Connector Enhancer Of Kinase Suppressor Of Ras 3, Connector Enhancer Of KSR 3, CNK Homolog Protein 3, CNK3, CNKSR Family Member 3, Maguin-like Protein, MAGI1, FLJ31349) (MaxLight 650)
125127-ML650 100 µL

CNKSR3 (Connector Enhancer Of Kinase Suppressor Of Ras 3, Connector Enhancer Of KSR 3, CNK Homolog Protein 3, CNK3, CNKSR Family Member 3, Maguin-like Protein, MAGI1, FLJ31349) (MaxLight 650)

Sign In for Pricing
View Details
ACAP2 (Arf-GAP with coiled-coil, ANK Repeat and PH Domain-Containing Protein 2, Centaurin-beta-2, Cnt-b2, ACAP2, CENTB2, KIAA0041) (Biotin) discontinued
302234-Biotin 200 µL

ACAP2 (Arf-GAP with coiled-coil, ANK Repeat and PH Domain-Containing Protein 2, Centaurin-beta-2, Cnt-b2, ACAP2, CENTB2, KIAA0041) (Biotin) discontinued

Sign In for Pricing
View Details
LRRC75B Antibody / FAM211B
RQ8550 100 µg

LRRC75B Antibody / FAM211B

Sign In for Pricing
View Details
SUMO, Pan (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, Small Ubiquitin-related Modifier 2, SUMO-2, Ubiquitin-like Protein SMT3B, SMT3 Homolog 2, Sentrin-2, HSMT3, SUMO-3, SMT3B, SMT3H2, Small Ubiquitin-related Modifier 3, SUMO-3, Ubiquitin-like Protein SMT3A, SMT3 Homolog 1, SUMO-2, SMT3A, SMT3H1)
S8026-01A 200 µL

SUMO, Pan (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, Small Ubiquitin-related Modifier 2, SUMO-2, Ubiquitin-like Protein SMT3B, SMT3 Homolog 2, Sentrin-2, HSMT3, SUMO-3, SMT3B, SMT3H2, Small Ubiquitin-related Modifier 3, SUMO-3, Ubiquitin-like Protein SMT3A, SMT3 Homolog 1, SUMO-2, SMT3A, SMT3H1)

Sign In for Pricing
View Details
ELISA Kit for Diacylglycerol-O-Acyltransferase Homolog 2 (DGAT2)
TRV-0004357-01 24 Tests

ELISA Kit for Diacylglycerol-O-Acyltransferase Homolog 2 (DGAT2)

Sign In for Pricing
View Details
ELISA Kit for Diacylglycerol-O-Acyltransferase Homolog 2 (DGAT2)
TRV-0004357-02 48 Tests

ELISA Kit for Diacylglycerol-O-Acyltransferase Homolog 2 (DGAT2)

Sign In for Pricing
View Details