Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD10 Rabbit Polyclonal Antibody (Biotin)

SAMD10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DJ591C20, C20orf136, dJ591C20.7

UniProt

Q9BYL1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAMD10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRSQRAASSRPIKLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_542188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNPDA2 (NM_138335) Human Tagged ORF Clone
RC202194 10 µg

GNPDA2 (NM_138335) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)
MBS1029429-01 0.02 mg (E-Coli)

Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)
MBS1029429-02 0.1 mg (E-Coli)

Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)
MBS1029429-03 0.02 mg (Yeast)

Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)
MBS1029429-04 0.1 mg (Yeast)

Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)
MBS1029429-05 0.02 mg (Baculovirus)

Recombinant Thermococcus onnurineus DNA-directed RNA polymerase subunit H (rpoH)

Sign In for Pricing
View Details