Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD10 Rabbit Polyclonal Antibody (Biotin)

SAMD10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DJ591C20, C20orf136, dJ591C20.7

UniProt

Q9BYL1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAMD10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRSQRAASSRPIKLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_542188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPT1 Over-expression Lysate Product
GWB-80F07E 0.1 mg

TRPT1 Over-expression Lysate Product

Sign In for Pricing
View Details
MSC (ABF1, BHLHA22, Musculin, Activated B Cell Factor 1, Class A Basic Helix-loop-helix Protein 22) (HRP)
MBS6153606-01 0.1 mL

MSC (ABF1, BHLHA22, Musculin, Activated B Cell Factor 1, Class A Basic Helix-loop-helix Protein 22) (HRP)

Sign In for Pricing
View Details
MSC (ABF1, BHLHA22, Musculin, Activated B Cell Factor 1, Class A Basic Helix-loop-helix Protein 22) (HRP)
MBS6153606-02 5x 0.1 mL

MSC (ABF1, BHLHA22, Musculin, Activated B Cell Factor 1, Class A Basic Helix-loop-helix Protein 22) (HRP)

Sign In for Pricing
View Details
Human hsa-miR-708-3p miRNA Agomir
abx880661-01 5 nmol

Human hsa-miR-708-3p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-708-3p miRNA Agomir
abx880661-02 10 nmol

Human hsa-miR-708-3p miRNA Agomir

Sign In for Pricing
View Details
PAAF1 Protein Vector (Human) (pPB-N-His)
PV029862 500 ng

PAAF1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details