Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEL1L2 Rabbit Polyclonal Antibody (Biotin)

SEL1L2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sel-1L2, C20orf50

UniProt

Q5TEA6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEL1L2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GDQLFKMGIKVLQQSKSQKQKEEAYLLFAKAADMGNLKAMEKMADALLFG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001258468

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPNS1 (NM_001142450) Human Tagged ORF Clone Lentiviral Particle
RC227643L3V 200 µL

SPNS1 (NM_001142450) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-TRIM33 (C-terminus) monoclonal Antibody
M03133 100 µL

Anti-TRIM33 (C-terminus) monoclonal Antibody

Sign In for Pricing
View Details
Porcine Ephrin Type A Receptor 6 (EPHA6) ELISA Kit
MBS9370004-01 48 Well

Porcine Ephrin Type A Receptor 6 (EPHA6) ELISA Kit

Sign In for Pricing
View Details
Porcine Ephrin Type A Receptor 6 (EPHA6) ELISA Kit
MBS9370004-02 96 Well

Porcine Ephrin Type A Receptor 6 (EPHA6) ELISA Kit

Sign In for Pricing
View Details
Porcine Ephrin Type A Receptor 6 (EPHA6) ELISA Kit
MBS9370004-03 5x 96 Well

Porcine Ephrin Type A Receptor 6 (EPHA6) ELISA Kit

Sign In for Pricing
View Details
Porcine Ephrin Type A Receptor 6 (EPHA6) ELISA Kit
MBS9370004-04 10x 96 Well

Porcine Ephrin Type A Receptor 6 (EPHA6) ELISA Kit

Sign In for Pricing
View Details