Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFT2D2 Rabbit Polyclonal Antibody (Biotin)

SFT2D2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UNQ512, dJ747L4.C1.2

UniProt

O95562

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SFT2D2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_955376

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alexa Fluor® 488 Mouse IgG2b, κ Isotype Control Antibody (S-844-22)
S0B1580-01 0.1 mg

Alexa Fluor® 488 Mouse IgG2b, κ Isotype Control Antibody (S-844-22)

Sign In for Pricing
View Details
Alexa Fluor® 488 Mouse IgG2b, κ Isotype Control Antibody (S-844-22)
S0B1580-02 0.5 mg

Alexa Fluor® 488 Mouse IgG2b, κ Isotype Control Antibody (S-844-22)

Sign In for Pricing
View Details
Alexa Fluor® 488 Mouse IgG2b, κ Isotype Control Antibody (S-844-22)
S0B1580-03 1 mg

Alexa Fluor® 488 Mouse IgG2b, κ Isotype Control Antibody (S-844-22)

Sign In for Pricing
View Details
Zglp1 Mouse shRNA Plasmid (Locus ID 100009600)
TL518523 1 Kit

Zglp1 Mouse shRNA Plasmid (Locus ID 100009600)

Sign In for Pricing
View Details
Anti-Prokineticin Receptor 2 (PKR2) Polyclonal antibody
FY-AB34326-01 1 mL

Anti-Prokineticin Receptor 2 (PKR2) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Prokineticin Receptor 2 (PKR2) Polyclonal antibody
FY-AB34326-02 100 µL

Anti-Prokineticin Receptor 2 (PKR2) Polyclonal antibody

Sign In for Pricing
View Details