Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLX1B Rabbit Polyclonal Antibody (Biotin)

SLX1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GIYD2

UniProt

Q9BQ83

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLX1B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphatidylinositol-glycan-specific Phospholipase D (GPLD1) BioAssayTM ELISA Kit (Rat) discontinued
587912 96 Tests

Phosphatidylinositol-glycan-specific Phospholipase D (GPLD1) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Anti-Plakophilin 2/PKP2 Antibody Picoband®, FITC Conjugate
A02146-1-FITC 100 µg/Vial

Anti-Plakophilin 2/PKP2 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Rab5b shRNA (UAS) - Lentiviral mouse Rab5b shRNA (UAS, RFP) (25)
GTR15245135 1 Vial

Lentiviral mouse Rab5b shRNA (UAS) - Lentiviral mouse Rab5b shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CD3E Monoclonal Antibody, FITC Conjugated
MBS7135355-01 0.1 mL

CD3E Monoclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
CD3E Monoclonal Antibody, FITC Conjugated
MBS7135355-02 5x 0.1 mL

CD3E Monoclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
NADK (NAD Kinase, Poly (P) /ATP NAD Kinase, dJ283E3.1, DKFZp686L22239, FLJ13052, FLJ37724, FLJ54695, FLJ77769, FLJ78247, FLJ78307, MGC1900) (AP) discontinued
130120-AP 100 µL

NADK (NAD Kinase, Poly (P) /ATP NAD Kinase, dJ283E3.1, DKFZp686L22239, FLJ13052, FLJ37724, FLJ54695, FLJ77769, FLJ78247, FLJ78307, MGC1900) (AP) discontinued

Sign In for Pricing
View Details