Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLX1B Rabbit Polyclonal Antibody (HRP)

SLX1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GIYD2

UniProt

Q9BQ83

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLX1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAUS3 (NM_024511) Human Over-expression Lysate
LH12005V 100 µg

HAUS3 (NM_024511) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Cycloxygenase-2 (COX-2) Monoclonal Antibody (Clone: COX2/1941)
36-3058-100 100 µg

Anti-Cycloxygenase-2 (COX-2) Monoclonal Antibody (Clone: COX2/1941)

Sign In for Pricing
View Details
Ethyl 5-amino-1- (4-bromophenyl) -4-cyanopyrazole-3-carboxylate
sc-300628 250 mg

Ethyl 5-amino-1- (4-bromophenyl) -4-cyanopyrazole-3-carboxylate

Sign In for Pricing
View Details
NEURL (Neuralized-Like Protein 1A, Neuralized Homolog (Drosophila) )
486774 100 µL

NEURL (Neuralized-Like Protein 1A, Neuralized Homolog (Drosophila) )

Sign In for Pricing
View Details
MLL5, NT (MLL5, KMT2E, Histone-lysine N-methyltransferase MLL5, Lysine N-methyltransferase 2E, Myeloid/lymphoid or mixed-lineage leukemia protein 5) (MaxLight 650) discontinued
038478-ML650 100 µL

MLL5, NT (MLL5, KMT2E, Histone-lysine N-methyltransferase MLL5, Lysine N-methyltransferase 2E, Myeloid/lymphoid or mixed-lineage leukemia protein 5) (MaxLight 650) discontinued

Sign In for Pricing
View Details
LOC668306 Mouse siRNA Oligo Duplex (Locus ID 668306)
SR400459 1 Kit

LOC668306 Mouse siRNA Oligo Duplex (Locus ID 668306)

Sign In for Pricing
View Details