Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLX1B Rabbit Polyclonal Antibody (HRP)

SLX1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GIYD2

UniProt

Q9BQ83

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLX1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Perilipin-2/ADFP Antibody (ADFP/1494) [Janelia Fluor 549]
NBP2-54598JF549 0.1 mL

Mouse Monoclonal Perilipin-2/ADFP Antibody (ADFP/1494) [Janelia Fluor 549]

Sign In for Pricing
View Details
TBCC Mouse Monoclonal Antibody [Clone ID: LBI3A10]
AMM12647VCF 100 µg

TBCC Mouse Monoclonal Antibody [Clone ID: LBI3A10]

Sign In for Pricing
View Details
Mouse Frizzled-1 (NP_067432) VersaClone cDNA
RDC0518 10 µg

Mouse Frizzled-1 (NP_067432) VersaClone cDNA

Sign In for Pricing
View Details
Lentiviral mouse Rpl21 shRNA (UAS) - Lentiviral mouse Rpl21 shRNA (UAS, RFP) plasmid
GTR15204673 1 Vial

Lentiviral mouse Rpl21 shRNA (UAS) - Lentiviral mouse Rpl21 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
KV2.1 (m) -PR
sc-146612-PR 10 µM - 20 µL

KV2.1 (m) -PR

Sign In for Pricing
View Details
Rabbit Monoclonal Mesothelin Antibody (MSLN/8391R) - Azide and BSA Free
NBP3-20894 100 µg

Rabbit Monoclonal Mesothelin Antibody (MSLN/8391R) - Azide and BSA Free

Sign In for Pricing
View Details