Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMCR8 Rabbit Polyclonal Antibody (HRP)

SMCR8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DENND8A

UniProt

Q8TEV9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SMCR8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STYYLHVQSMLTQLCSKAFLYTFCHHLHLPTHDKETEELVASRQMSFLKL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

937kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLL1 Recombinant Protein Fc Tag Lyophilized
MBS8430953-01 0.01 mg

DLL1 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
DLL1 Recombinant Protein Fc Tag Lyophilized
MBS8430953-02 0.05 mg

DLL1 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
DLL1 Recombinant Protein Fc Tag Lyophilized
MBS8430953-03 5x 0.05 mg

DLL1 Recombinant Protein Fc Tag Lyophilized

Sign In for Pricing
View Details
EAF2 (NM_018456) Human Mass Spec Standard
PH304314 10 µg

EAF2 (NM_018456) Human Mass Spec Standard

Sign In for Pricing
View Details
POU5F1P3 siRNA Oligos set (Human)
37271171 3x 5 nmol

POU5F1P3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Hamster Vinculin ELISA Kit
MBS007393-01 48 Well

Hamster Vinculin ELISA Kit

Sign In for Pricing
View Details