Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATS2L Rabbit Polyclonal Antibody (Biotin)

SPATS2L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SGNP, DNAPTP6

UniProt

Q9NUQ6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPATS2L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VDKAVQAFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ppp2r1a qPCR Primer Pair
QM06386S 200 Tests

Mouse Ppp2r1a qPCR Primer Pair

Sign In for Pricing
View Details
Anti-MUC2 (Rabbit, Monoclonal)
A104917 100 µL

Anti-MUC2 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Anti-CD151 Antibody (Pierre Fabre patent anti-CD151)
F1142-50 50 mg

Anti-CD151 Antibody (Pierre Fabre patent anti-CD151)

Sign In for Pricing
View Details
Anti-TAB1 Antibody
PB9445 100 µg/Vial

Anti-TAB1 Antibody

Sign In for Pricing
View Details
Na+ CP type VIIIalpha (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-Gated sodium Channel Subunit alpha Nav1.6, SCN8A, MED) discontinued
224397-01 50 µL

Na+ CP type VIIIalpha (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-Gated sodium Channel Subunit alpha Nav1.6, SCN8A, MED) discontinued

Sign In for Pricing
View Details
Na+ CP type VIIIalpha (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-Gated sodium Channel Subunit alpha Nav1.6, SCN8A, MED) discontinued
224397-02 100 µL

Na+ CP type VIIIalpha (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-Gated sodium Channel Subunit alpha Nav1.6, SCN8A, MED) discontinued

Sign In for Pricing
View Details