Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATS2L Rabbit Polyclonal Antibody (HRP)

SPATS2L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SGNP, DNAPTP6

UniProt

Q9NUQ6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPATS2L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDKAVQAFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vascular cell adhesion molecule 1, VCAM-1 ELISA Kit
MBS160905-01 48 Well

Mouse Vascular cell adhesion molecule 1, VCAM-1 ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular cell adhesion molecule 1, VCAM-1 ELISA Kit
MBS160905-02 96 Well

Mouse Vascular cell adhesion molecule 1, VCAM-1 ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular cell adhesion molecule 1, VCAM-1 ELISA Kit
MBS160905-03 5x 96 Well

Mouse Vascular cell adhesion molecule 1, VCAM-1 ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular cell adhesion molecule 1, VCAM-1 ELISA Kit
MBS160905-04 10x 96 Well

Mouse Vascular cell adhesion molecule 1, VCAM-1 ELISA Kit

Sign In for Pricing
View Details
Glycerol Kinase 2 (Glycerol Kinase Testis Specific 2, Glycerokinase 2, GK 2, GK2, ATP:glycerol 3-phosphotransferase, GKP2, GKTA) (MaxLight 750) discontinued
127379-ML750 100 µL

Glycerol Kinase 2 (Glycerol Kinase Testis Specific 2, Glycerokinase 2, GK 2, GK2, ATP:glycerol 3-phosphotransferase, GKP2, GKTA) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RNF138 Blocking Peptide
MBS8202911-01 1 mg

RNF138 Blocking Peptide

Sign In for Pricing
View Details