Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE2B Rabbit Polyclonal Antibody (FITC)

SPDYE2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SPDYE2L

UniProt

A6NHP3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPDYE2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPSPPCRS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_001159811

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rhox3h shRNA (UAS) - Lentiviral mouseRhox3h shRNA (UAS, GFP) (25)
GTR15298295 1 Vial

Lentiviral mouse Rhox3h shRNA (UAS) - Lentiviral mouseRhox3h shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TSHB (Thyrotropin Subunit beta, Thyroid-stimulating Hormone Subunit beta, TSH-B, TSH-beta, Thyrotropin beta Chain, Thyrotropin alfa) discontinued
T5400-22R 100 µg

TSHB (Thyrotropin Subunit beta, Thyroid-stimulating Hormone Subunit beta, TSH-B, TSH-beta, Thyrotropin beta Chain, Thyrotropin alfa) discontinued

Sign In for Pricing
View Details
Human Ubiquitin Cross Reactive Protein ELISA Kit
MBS093260-01 48 Well

Human Ubiquitin Cross Reactive Protein ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin Cross Reactive Protein ELISA Kit
MBS093260-02 96 Well

Human Ubiquitin Cross Reactive Protein ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin Cross Reactive Protein ELISA Kit
MBS093260-03 5x 96 Well

Human Ubiquitin Cross Reactive Protein ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin Cross Reactive Protein ELISA Kit
MBS093260-04 10x 96 Well

Human Ubiquitin Cross Reactive Protein ELISA Kit

Sign In for Pricing
View Details