Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE2B Rabbit Polyclonal Antibody (Biotin)

SPDYE2B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SPDYE2L

UniProt

A6NHP3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPDYE2B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SMNPRARKNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IGFBP3 Antibody (Capture)
MBS8327297-01 0.1 mg

Anti-IGFBP3 Antibody (Capture)

Sign In for Pricing
View Details
Anti-IGFBP3 Antibody (Capture)
MBS8327297-02 1 mg

Anti-IGFBP3 Antibody (Capture)

Sign In for Pricing
View Details
Anti-IGFBP3 Antibody (Capture)
MBS8327297-03 5x 1 mg

Anti-IGFBP3 Antibody (Capture)

Sign In for Pricing
View Details
GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A, GluR-K1, Glutamate Receptor Ionotropic AMPA 1, GluA1, GRIA1, HBGR1, MGC133252) (AP) discontinued
127363-AP 100 µL

GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A, GluR-K1, Glutamate Receptor Ionotropic AMPA 1, GluA1, GRIA1, HBGR1, MGC133252) (AP) discontinued

Sign In for Pricing
View Details
Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (HRP)
T8665-13E1-HRP 100 µL

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (HRP)

Sign In for Pricing
View Details
GPR142, NT (GPR142, PGR2, Probable G-protein coupled receptor 142, G-protein coupled receptor PGR2)
036222 200 µL

GPR142, NT (GPR142, PGR2, Probable G-protein coupled receptor 142, G-protein coupled receptor PGR2)

Sign In for Pricing
View Details