Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLCD1 Rabbit Polyclonal Antibody (FITC)

TLCD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

A8MYP9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TLCD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001153879

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ipratropium Bromide
C07977 50 mg

Ipratropium Bromide

Sign In for Pricing
View Details
1700057G04Rik ORF Vector (Mouse) (pORF)
ORF036823 1.0 µg DNA

1700057G04Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
KIR2DL4 (CD158D, KIR103AS, Killer Cell Immunoglobulin-like Receptor 2DL4, CD158 Antigen-like Family Member D, G9P, Killer Cell Inhibitory Receptor 103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d) (AP) discontinued
128832-AP 100 µL

KIR2DL4 (CD158D, KIR103AS, Killer Cell Immunoglobulin-like Receptor 2DL4, CD158 Antigen-like Family Member D, G9P, Killer Cell Inhibitory Receptor 103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d) (AP) discontinued

Sign In for Pricing
View Details
Covault Ovariectomy Hooks Blunt
0515-2 8 Inches

Covault Ovariectomy Hooks Blunt

Sign In for Pricing
View Details
MRPL24 (39S Ribosomal Protein L24, Mitochondrial)
486112 100 µL

MRPL24 (39S Ribosomal Protein L24, Mitochondrial)

Sign In for Pricing
View Details
FUNDC1 siRNA (Human)
MBS8237484-01 15 nmol

FUNDC1 siRNA (Human)

Sign In for Pricing
View Details