Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED5 Rabbit Polyclonal Antibody (HRP)

TMED5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P28, p24g2, CGI-100

UniProt

Q9Y3A6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMED5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: INSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057124

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CDC20 sgRNA gene knockout kit - Lentiviral human CDC20 sgRNA gene knockout kit (plasmid)
GTR15385364 1 Vial

Lentiviral human CDC20 sgRNA gene knockout kit - Lentiviral human CDC20 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Adhesamine diTFA
orb2665091-01 50 mg

Adhesamine diTFA

Sign In for Pricing
View Details
Adhesamine diTFA
orb2665091-02 10 mg

Adhesamine diTFA

Sign In for Pricing
View Details
Recombinant Human Ferritin light chain (FTL)
CSB-EP009049HU-01 20 µg

Recombinant Human Ferritin light chain (FTL)

Sign In for Pricing
View Details
Recombinant Human Ferritin light chain (FTL)
CSB-EP009049HU-02 100 µg

Recombinant Human Ferritin light chain (FTL)

Sign In for Pricing
View Details
Recombinant Human Ferritin light chain (FTL)
CSB-EP009049HU-03 1 mg

Recombinant Human Ferritin light chain (FTL)

Sign In for Pricing
View Details