Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED6 Rabbit Polyclonal Antibody (HRP)

TMED6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P24g5, PRO34237, SPLL9146

UniProt

Q8WW62

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMED6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653277

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFYC (NM_001142590) Human Over-expression Lysate
LC428193 20 µg

NFYC (NM_001142590) Human Over-expression Lysate

Sign In for Pricing
View Details
CD133 (PROM1) Rabbit Polyclonal Antibody
TA380398 100 µL

CD133 (PROM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CD5 Protein (aa 24-370, His Tag)
PKSM041222-01 10 µg

Recombinant Mouse CD5 Protein (aa 24-370, His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD5 Protein (aa 24-370, His Tag)
PKSM041222-02 50 µg

Recombinant Mouse CD5 Protein (aa 24-370, His Tag)

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF405S conjugate, 0.1mg/mL
BNC041260-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) (NM_001135699) Human Over-expression Lysate
LY427673 100 µg

14-3-3 zeta (YWHAZ) (NM_001135699) Human Over-expression Lysate

Sign In for Pricing
View Details