Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM16 Rabbit Polyclonal Antibody (HRP)

TRIM16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EBBP

UniProt

O95361

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TRIM16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 2C8/9/18/19 Antibody
8C12264-AAT 50 µg

Cytochrome P450 2C8/9/18/19 Antibody

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), 0.2mg/mL
BNUB1484-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), 0.2mg/mL

Sign In for Pricing
View Details
Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF594 conjugate, 0.1mg/mL
BNC942987-100 1x 100 µL

Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit
E-EL-H0778-01 24 Tests

Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit

Sign In for Pricing
View Details
Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit
E-EL-H0778-02 48 Tests

Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit

Sign In for Pricing
View Details
Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit
E-EL-H0778-03 96 Tests

Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit

Sign In for Pricing
View Details