Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM64 Rabbit Polyclonal Antibody (FITC)

TRIM64 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRIM64A, C11orf28

UniProt

A6NGJ6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRIM64

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KPNFNTNVVLKKLSSLARQTRPQNINSSDNICVLHEETKELFCEADKRLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001129958

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSH2D Rabbit Polyclonal Antibody (PE-Cy5)
orb916474 100 µL

HSH2D Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
OBFC1 (STN1, CST Complex Subunit STN1, Oligonucleotide/Oligosaccharide-binding Fold-containing Protein 1, Suppressor of cdc Thirteen Homolog, FLJ22559, RP11-541N10.2, RPA-32, BA541N10.2, AAF44, AAF-44, bA541N10.2) (AP)
MBS6387898-01 0.1 mL

OBFC1 (STN1, CST Complex Subunit STN1, Oligonucleotide/Oligosaccharide-binding Fold-containing Protein 1, Suppressor of cdc Thirteen Homolog, FLJ22559, RP11-541N10.2, RPA-32, BA541N10.2, AAF44, AAF-44, bA541N10.2) (AP)

Sign In for Pricing
View Details
OBFC1 (STN1, CST Complex Subunit STN1, Oligonucleotide/Oligosaccharide-binding Fold-containing Protein 1, Suppressor of cdc Thirteen Homolog, FLJ22559, RP11-541N10.2, RPA-32, BA541N10.2, AAF44, AAF-44, bA541N10.2) (AP)
MBS6387898-02 5x 0.1 mL

OBFC1 (STN1, CST Complex Subunit STN1, Oligonucleotide/Oligosaccharide-binding Fold-containing Protein 1, Suppressor of cdc Thirteen Homolog, FLJ22559, RP11-541N10.2, RPA-32, BA541N10.2, AAF44, AAF-44, bA541N10.2) (AP)

Sign In for Pricing
View Details
NUDT1 (7,8-dihydro-8-oxoguanine Triphosphatase, 2-hydroxy-dATP Diphosphatase, 8-oxo-dGTPase, Nucleoside Diphosphate-linked Moiety X Motif 1, Nudix Motif 1, MTH1) (PE)
130621-PE 100 µL

NUDT1 (7,8-dihydro-8-oxoguanine Triphosphatase, 2-hydroxy-dATP Diphosphatase, 8-oxo-dGTPase, Nucleoside Diphosphate-linked Moiety X Motif 1, Nudix Motif 1, MTH1) (PE)

Sign In for Pricing
View Details
TMEM107 siRNA (Human)
MBS8206335-01 15 nmol

TMEM107 siRNA (Human)

Sign In for Pricing
View Details
TMEM107 siRNA (Human)
MBS8206335-02 30 nmol

TMEM107 siRNA (Human)

Sign In for Pricing
View Details