Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC22 Rabbit Polyclonal Antibody (HRP)

TTC22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5TAA0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TTC22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AARCLAEQGYAHGFDVGCASPEERARGLAAGIALYDKALGYGQQIPMEEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Spike-RBD fully human mAb (IgG) Humanized Antibody
MBS8574763-01 0.05 mg

Anti-Spike-RBD fully human mAb (IgG) Humanized Antibody

Sign In for Pricing
View Details
Anti-Spike-RBD fully human mAb (IgG) Humanized Antibody
MBS8574763-02 5x 0.05 mg

Anti-Spike-RBD fully human mAb (IgG) Humanized Antibody

Sign In for Pricing
View Details
IgE (epsilon Chain) (Rhodamine) discontinued
I1900-42E7 1 mg

IgE (epsilon Chain) (Rhodamine) discontinued

Sign In for Pricing
View Details
Psmd4 ORF Vector (Mouse) (pORF)
ORF055115 1.0 µg DNA

Psmd4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
His Tag Rabbit pAb
ATL1000-01 30 µL

His Tag Rabbit pAb

Sign In for Pricing
View Details
His Tag Rabbit pAb
ATL1000-02 50 μL

His Tag Rabbit pAb

Sign In for Pricing
View Details