Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC26 Rabbit Polyclonal Antibody (HRP)

TTC26 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DYF13, IFT56, dyf-13

UniProt

A0AVF1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TTC26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079202

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLIPR2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-8411R-PerCP-Cy5.5 100 µL

GLIPR2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Kv1.2 (KCNA2) mouse monoclonal antibody
MO50016-100 100 µL

Kv1.2 (KCNA2) mouse monoclonal antibody

Sign In for Pricing
View Details
QPRT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1766405 3x 1.0 µg

QPRT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua UPF0299 membrane protein YpAngola_A3025 (YpAngola_A3025)
MBS7041498-01 0.02 mg

Recombinant Yersinia pestis bv. Antiqua UPF0299 membrane protein YpAngola_A3025 (YpAngola_A3025)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua UPF0299 membrane protein YpAngola_A3025 (YpAngola_A3025)
MBS7041498-02 0.1 mg

Recombinant Yersinia pestis bv. Antiqua UPF0299 membrane protein YpAngola_A3025 (YpAngola_A3025)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua UPF0299 membrane protein YpAngola_A3025 (YpAngola_A3025)
MBS7041498-03 5x 0.1 mg

Recombinant Yersinia pestis bv. Antiqua UPF0299 membrane protein YpAngola_A3025 (YpAngola_A3025)

Sign In for Pricing
View Details