Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC30A Rabbit Polyclonal Antibody (FITC)

TTC30A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FAP259, IFT70A, TTC30B

UniProt

Q86WT1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TTC30A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689488

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progranulin, Recombinant, Rat, aa1-602, FLAG-Tag (Granulins, Grn, Acrogranin) discontinued
169726 10 µg

Progranulin, Recombinant, Rat, aa1-602, FLAG-Tag (Granulins, Grn, Acrogranin) discontinued

Sign In for Pricing
View Details
TTC6 Rabbit Polyclonal Antibody (FITC)
orb2114313 100 µL

TTC6 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Proteasome 26S Subunit, ATPase 2 (PSMC2)
MBS2077696-01 0.1 mL

APC-Linked Polyclonal Antibody to Proteasome 26S Subunit, ATPase 2 (PSMC2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Proteasome 26S Subunit, ATPase 2 (PSMC2)
MBS2077696-02 0.2 mL

APC-Linked Polyclonal Antibody to Proteasome 26S Subunit, ATPase 2 (PSMC2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Proteasome 26S Subunit, ATPase 2 (PSMC2)
MBS2077696-03 0.5 mL

APC-Linked Polyclonal Antibody to Proteasome 26S Subunit, ATPase 2 (PSMC2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Proteasome 26S Subunit, ATPase 2 (PSMC2)
MBS2077696-04 1 mL

APC-Linked Polyclonal Antibody to Proteasome 26S Subunit, ATPase 2 (PSMC2)

Sign In for Pricing
View Details