Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC39C Rabbit Polyclonal Antibody (FITC)

TTC39C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HsT2697, C18orf17

UniProt

Q8N584

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TTC39C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694943

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Arrestin Beta 2 (ARRb2) ELISA Kit
MBS2024661-01 24 Strip Well

Human Arrestin Beta 2 (ARRb2) ELISA Kit

Sign In for Pricing
View Details
Human Arrestin Beta 2 (ARRb2) ELISA Kit
MBS2024661-02 48 Well

Human Arrestin Beta 2 (ARRb2) ELISA Kit

Sign In for Pricing
View Details
Human Arrestin Beta 2 (ARRb2) ELISA Kit
MBS2024661-03 96 Well

Human Arrestin Beta 2 (ARRb2) ELISA Kit

Sign In for Pricing
View Details
Human Arrestin Beta 2 (ARRb2) ELISA Kit
MBS2024661-04 5x 96 Well

Human Arrestin Beta 2 (ARRb2) ELISA Kit

Sign In for Pricing
View Details
Human Arrestin Beta 2 (ARRb2) ELISA Kit
MBS2024661-05 10x 96 Well

Human Arrestin Beta 2 (ARRb2) ELISA Kit

Sign In for Pricing
View Details
Mouse Signal Transducer and Activator of Transcription 6 ELISA Kit
MBS030958-01 48 Well

Mouse Signal Transducer and Activator of Transcription 6 ELISA Kit

Sign In for Pricing
View Details