Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC39C Rabbit Polyclonal Antibody (HRP)

TTC39C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HsT2697, C18orf17

UniProt

Q8N584

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TTC39C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694943

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human T cell receptor alpha variable 24 (TVA24)
orb3007103-01 20 µg

Recombinant Human T cell receptor alpha variable 24 (TVA24)

Sign In for Pricing
View Details
Recombinant Human T cell receptor alpha variable 24 (TVA24)
orb3007103-02 100 µg

Recombinant Human T cell receptor alpha variable 24 (TVA24)

Sign In for Pricing
View Details
Recombinant Human T cell receptor alpha variable 24 (TVA24)
orb3007103-03 1 mg

Recombinant Human T cell receptor alpha variable 24 (TVA24)

Sign In for Pricing
View Details
PDGFRL (Platelet-derived Growth Factor Receptor-like Protein, PDGFR-like Protein, PDGF Receptor beta-like Tumor Suppressor, PDGFRL, PRLTS)
406873-01 50 µL

PDGFRL (Platelet-derived Growth Factor Receptor-like Protein, PDGFR-like Protein, PDGF Receptor beta-like Tumor Suppressor, PDGFRL, PRLTS)

Sign In for Pricing
View Details
PDGFRL (Platelet-derived Growth Factor Receptor-like Protein, PDGFR-like Protein, PDGF Receptor beta-like Tumor Suppressor, PDGFRL, PRLTS)
406873-02 100 µL

PDGFRL (Platelet-derived Growth Factor Receptor-like Protein, PDGFR-like Protein, PDGF Receptor beta-like Tumor Suppressor, PDGFRL, PRLTS)

Sign In for Pricing
View Details
Human SEMA5B Knockout HEK293T cell line
GTR15422830 1 Vial

Human SEMA5B Knockout HEK293T cell line

Sign In for Pricing
View Details