Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBAL3 Rabbit Polyclonal Antibody (FITC)

TUBAL3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

A6NHL2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TUBAL3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TRKLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK Antibody
F50188-0.4ML 0.4 mL

AMPK Antibody

Sign In for Pricing
View Details
Snrnp27 Mouse Gene Knockout Kit (CRISPR)
KN516395 1 Kit

Snrnp27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PPIA Rabbit Monoclonal Antibody [Clone ID: 24GB905]
TA425055 100 µL

PPIA Rabbit Monoclonal Antibody [Clone ID: 24GB905]

Sign In for Pricing
View Details
c Fos (FOS) pSer374 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 34E4]
AM00061PU-N 100 µg

c Fos (FOS) pSer374 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 34E4]

Sign In for Pricing
View Details
Biological Safety Cabinet Class I BCBS-104
BCBS-104 1 Unit

Biological Safety Cabinet Class I BCBS-104

Sign In for Pricing
View Details
BMP4 Recombinant Rabbit Monoclonal Antibody [JE42-44]
HA721953 100 µL

BMP4 Recombinant Rabbit Monoclonal Antibody [JE42-44]

Sign In for Pricing
View Details