Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP41 Rabbit Polyclonal Antibody (FITC)

USP41 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q3LFD5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human USP41

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf120 3'UTR Luciferase Stable Cell Line
TU002625 1.0 mL

C9orf120 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Sodium hydroxide solution 32 % p.A.
LC-6844.1 1 L

Sodium hydroxide solution 32 % p.A.

Sign In for Pricing
View Details
Lentiviral human TRPM3 sgRNA gene knockout kit - Lentiviral human TRPM3 sgRNA gene knockout kit (100)
GTR15367558 1 Vial

Lentiviral human TRPM3 sgRNA gene knockout kit - Lentiviral human TRPM3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
5-Methyl-3- (6-trifluoromethyl-pyridin-3-yl) -isoxazole-4-carbothioic acid S- (3-chloro-phenyl) ester
PC109748 250 mg

5-Methyl-3- (6-trifluoromethyl-pyridin-3-yl) -isoxazole-4-carbothioic acid S- (3-chloro-phenyl) ester

Sign In for Pricing
View Details
Rabbit Monoclonal NELL2 Antibody (055) [Alexa Fluor 700]
NBP2-90179AF700 0.1 mL

Rabbit Monoclonal NELL2 Antibody (055) [Alexa Fluor 700]

Sign In for Pricing
View Details
TOX2 Human shRNA Plasmid Kit (Locus ID 84969)
TR305970 1 Kit

TOX2 Human shRNA Plasmid Kit (Locus ID 84969)

Sign In for Pricing
View Details