Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR59 Rabbit Polyclonal Antibody (Biotin)

WDR59 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDW12, FP977, p90-120

UniProt

Q6PJI9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR59

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-6894-3p Primers
MPH03814 150 µL / 10 µM

hsa-miR-6894-3p Primers

Sign In for Pricing
View Details
Mouse Plin2 qPCR Primer Pair
QM09222S 200 Tests

Mouse Plin2 qPCR Primer Pair

Sign In for Pricing
View Details
ATP5A1P9 Recombinant Protein (Human)
RP047845 100 µg

ATP5A1P9 Recombinant Protein (Human)

Sign In for Pricing
View Details
DHB13, NT (HSD17B13, SCDR9, 17-beta-hydroxysteroid dehydrogenase 13, Short-chain dehydrogenase/reductase 9)
034606 200 µL

DHB13, NT (HSD17B13, SCDR9, 17-beta-hydroxysteroid dehydrogenase 13, Short-chain dehydrogenase/reductase 9)

Sign In for Pricing
View Details
NOTCH4 Rabbit Polyclonal Antibody (Cy7)
orb1075156 100 µL

NOTCH4 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Lentiviral mouse Ffar2 shRNA (UAS) - Lentiviral mouse Ffar2 shRNA (UAS, GFP) plasmid
GTR15291238 1 Vial

Lentiviral mouse Ffar2 shRNA (UAS) - Lentiviral mouse Ffar2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details