Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR59 Rabbit Polyclonal Antibody (Biotin)

WDR59 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDW12, FP977, p90-120

UniProt

Q6PJI9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR59

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTBDN Polyclonal Antibody
orb616667-01 50 μL

RTBDN Polyclonal Antibody

Sign In for Pricing
View Details
RTBDN Polyclonal Antibody
orb616667-02 100 µL

RTBDN Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)
MBS7031237-01 0.02 mg

Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)
MBS7031237-02 0.1 mg

Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)
MBS7031237-03 5x 0.1 mg

Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Sign In for Pricing
View Details
Recombinant Candida glabrata Cytochrome b-c1 complex subunit 2, mitochondrial (QCR2)
MBS1480864-01 0.05 mg (E-Coli)

Recombinant Candida glabrata Cytochrome b-c1 complex subunit 2, mitochondrial (QCR2)

Sign In for Pricing
View Details